PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02749.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 316aa    MW: 34892.6 Da    PI: 9.6572
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02749.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-3961121262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknkkss
  Rsa1.0_02749.1_g00002.1  61 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKKSS 121
                              6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3060119IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3363119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6365119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MINVKPMDQM ISNTNNNNTS QQQQTTFMAT TTRPNATAAN VGSGGNNNNT ATTMESRKAR  60
PQEKVNCPRC NSTNTKFCYY NNYSLTQPRY FCKGCRRYWT EGGSLRNVPV GGSSRKNKKS  120
STPLASHSNP KLPDLNPPVL FSSQIPNKSS KDLNLLSFPV MQDHHHGMSQ FLHMPKIENN  180
NTSSSIYASS SPVSALELLR SNGVSSRGMN TFLPGQMLDS NSVIYSSLGF PTMVDYKQSN  240
NNLSFSIDHH QGIGNNTINS NQRPEDNNHA DDMNGASRVL FPFSDMKELS STAQDKSHGN  300
NTYWSGMFTN TGGSSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604929.10.0PREDICTED: dof zinc finger protein DOF3.7 isoform X1
RefseqXP_013604930.10.0PREDICTED: dof zinc finger protein DOF3.7 isoform X2
SwissprotQ433851e-177DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0D3DUY20.0A0A0D3DUY2_BRAOL; Uncharacterized protein
STRINGBra007632.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-173Dof family protein